Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TKFC Rabbit Polyclonal Antibody (HRP)

TKFC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Da, Dak, BC021917

UniProt

Q8VC30

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAGLVASNPDLQLLQGHRVALRSDLDTLKGRVALLSGGGSGHEPAHAGFI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_663471

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IAH1 Knockout A2780 Polyclonal Cells
ARG29171 1 Million

IAH1 Knockout A2780 Polyclonal Cells

Sign In for Pricing
View Details
RBM12 CRISPRa sgRNA lentivector (set of three targets)(Human)
38596121 3x 1.0µg DNA

RBM12 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Human Caspase 3 (CASP3) ELISA Kit
RD-CASP3-Hu-01 96 Tests

Human Caspase 3 (CASP3) ELISA Kit

Sign In for Pricing
View Details
Human Caspase 3 (CASP3) ELISA Kit
RD-CASP3-Hu-02 48 Tests

Human Caspase 3 (CASP3) ELISA Kit

Sign In for Pricing
View Details
FAM193A ORF Vector (Human) (pORF)
19890011 1.0 µg DNA

FAM193A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
GGCT Recombinant Protein
OPCA01614-100UG 100 µg

GGCT Recombinant Protein

Sign In for Pricing
View Details