Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSM14A Rabbit Polyclonal Antibody (HRP)

LSM14A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAP55, FAM61A, RAP55A, C19orf13

UniProt

Q8ND56

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LSM14A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056393

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGAT1 CytoSection
TS425735P5 25 Slides

MGAT1 CytoSection

Sign In for Pricing
View Details
Goat Anti-Human IgG+IgM+IgA - AcalephFluor680
CSA4006-01 100 µL

Goat Anti-Human IgG+IgM+IgA - AcalephFluor680

Sign In for Pricing
View Details
Goat Anti-Human IgG+IgM+IgA - AcalephFluor680
CSA4006-02 500 μL

Goat Anti-Human IgG+IgM+IgA - AcalephFluor680

Sign In for Pricing
View Details
Goat Anti-Human IgG+IgM+IgA - AcalephFluor680
CSA4006-03 1 mL

Goat Anti-Human IgG+IgM+IgA - AcalephFluor680

Sign In for Pricing
View Details
Rabbit Monoclonal Coagulation Factor VII Antibody (121) [mFluor Violet 450 SE]
NBP2-90369MFV450 0.1 mL

Rabbit Monoclonal Coagulation Factor VII Antibody (121) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
TUB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2557008 1.0 µg DNA

TUB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details