Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC69 Rabbit Polyclonal Antibody (Biotin)

CCDC69 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DKFZP434C171, FLJ13705

UniProt

A6NI79

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCDC69

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_056436

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Linked Monoclonal Antibody to Interleukin 17 (IL17)
MBS2127873-01 0.1 mL

PE Linked Monoclonal Antibody to Interleukin 17 (IL17)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Interleukin 17 (IL17)
MBS2127873-02 0.2 mL

PE Linked Monoclonal Antibody to Interleukin 17 (IL17)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Interleukin 17 (IL17)
MBS2127873-03 0.5 mL

PE Linked Monoclonal Antibody to Interleukin 17 (IL17)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Interleukin 17 (IL17)
MBS2127873-04 1 mL

PE Linked Monoclonal Antibody to Interleukin 17 (IL17)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Interleukin 17 (IL17)
MBS2127873-05 5 mL

PE Linked Monoclonal Antibody to Interleukin 17 (IL17)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Interleukin 17 (IL17)
MBS2127873-06 5x 5 mL

PE Linked Monoclonal Antibody to Interleukin 17 (IL17)

Sign In for Pricing
View Details