Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC69 Rabbit Polyclonal Antibody (HRP)

CCDC69 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZP434C171, FLJ13705

UniProt

A6NI79

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCDC69

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_056436

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oligo, 5'-GCG GGC GGT TGT ATA GCG G-3' (19mer)
MBS634257-01 0.033 mg

Oligo, 5'-GCG GGC GGT TGT ATA GCG G-3' (19mer)

Sign In for Pricing
View Details
Oligo, 5'-GCG GGC GGT TGT ATA GCG G-3' (19mer)
MBS634257-02 5x 0.033 mg

Oligo, 5'-GCG GGC GGT TGT ATA GCG G-3' (19mer)

Sign In for Pricing
View Details
NCSTN Antibody
OACD05917-1ML 1 mL

NCSTN Antibody

Sign In for Pricing
View Details
Lentiviral human CHPF2 sgRNA gene knockout kit - Lentiviral human CHPF2 sgRNA gene knockout kit (plasmid)
GTR15399686 1 Vial

Lentiviral human CHPF2 sgRNA gene knockout kit - Lentiviral human CHPF2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
PSMA4 Rabbit Polyclonal Antibody (Biotin)
orb448619 100 µL

PSMA4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
ODAM (NM_017855) Human Over-expression Lysate
LH10485V 100 µg

ODAM (NM_017855) Human Over-expression Lysate

Sign In for Pricing
View Details