Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ldlrap1 Rabbit Polyclonal Antibody (Biotin)

Ldlrap1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

A, Ar, Arh, ARH2, Arh1, FHCB1, FHCB2, AA691260

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ldlrap1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: APLSTVSANTNNVDETPRPQVLGNNSVVWELDDGLDEAFSRLAQSRTNPQ

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_663529

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acinus, NT (AAE7, ACN1, AC NON-UTILIZING 1, ACYL-ACTIVATING ENZYME 7, AT3G16910.1) (APC) discontinued
A0600-15-APC 100 µL

Acinus, NT (AAE7, ACN1, AC NON-UTILIZING 1, ACYL-ACTIVATING ENZYME 7, AT3G16910.1) (APC) discontinued

Sign In for Pricing
View Details
Syntaxin (Synaptotagmin-Associated 35kD Protein, Neuron-Specific Antigen HPC-1) (MaxLight 750) discontinued
S9200-02A-ML750 100 µL

Syntaxin (Synaptotagmin-Associated 35kD Protein, Neuron-Specific Antigen HPC-1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
HEY1 Protein Vector (Human) (pPB-C-His)
PV019477 500 ng

HEY1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
WWP1 Protein Vector (Rat) (pPM-C-HA)
PV316764 500 ng

WWP1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Cubilin Rabbit pAb, PerCP-Cy7 conjugated
orb2842660 100 µL

Cubilin Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
PEPD
571910-01 50 µg

PEPD

Sign In for Pricing
View Details