Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ldlrap1 Rabbit Polyclonal Antibody (FITC)

Ldlrap1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

A, Ar, Arh, ARH2, Arh1, FHCB1, FHCB2, AA691260

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ldlrap1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: APLSTVSANTNNVDETPRPQVLGNNSVVWELDDGLDEAFSRLAQSRTNPQ

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_663529

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF660 siRNA (h)
sc-78415 10 µM

ZNF660 siRNA (h)

Sign In for Pricing
View Details
C6orf15 3'UTR Luciferase Stable Cell Line
TU002376 1.0 mL

C6orf15 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Cofilin 2 (CFL2) Chicken ELISA Kit
C3078 96 Tests

Cofilin 2 (CFL2) Chicken ELISA Kit

Sign In for Pricing
View Details
Bovine serum, 100 ml
RIN.SE.0100 100 mL

Bovine serum, 100 ml

Sign In for Pricing
View Details
Human LRRC58 shRNA Plasmid
abx964479-01 150 µg

Human LRRC58 shRNA Plasmid

Sign In for Pricing
View Details
Human LRRC58 shRNA Plasmid
abx964479-02 300 µg

Human LRRC58 shRNA Plasmid

Sign In for Pricing
View Details