Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ldlrap1 Rabbit Polyclonal Antibody (HRP)

Ldlrap1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A, Ar, Arh, ARH2, Arh1, FHCB1, FHCB2, AA691260

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ldlrap1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APLSTVSANTNNVDETPRPQVLGNNSVVWELDDGLDEAFSRLAQSRTNPQ

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_663529

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf50 Knockout jurkat Polyclonal Cells
ARG41328 1 Million

C1orf50 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
TRIM62 (Tripartite Motif-containing Protein 62) (MaxLight 650)
MBS6397245-01 0.1 mL

TRIM62 (Tripartite Motif-containing Protein 62) (MaxLight 650)

Sign In for Pricing
View Details
TRIM62 (Tripartite Motif-containing Protein 62) (MaxLight 650)
MBS6397245-02 5x 0.1 mL

TRIM62 (Tripartite Motif-containing Protein 62) (MaxLight 650)

Sign In for Pricing
View Details
PGAP2, CT (PGAP2, FRAG1, Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1) (AP) discontinued
039913-AP 200 µL

PGAP2, CT (PGAP2, FRAG1, Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1) (AP) discontinued

Sign In for Pricing
View Details
At3g02930 Antibody
orb796292 2 mg

At3g02930 Antibody

Sign In for Pricing
View Details
ACP antibody
orb72214 100 µL

ACP antibody

Sign In for Pricing
View Details