Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Traf3ip1 Rabbit Polyclonal Antibody (HRP)

Traf3ip1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MIP-, MIP-T3, AU041749, 3930402D05Rik

UniProt

Q149C2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Traf3ip1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VIRITGFMKGLYTDAEMKSENVKDKDAKISFLQKAIDVVMMVSGEPLAAK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_082994

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNL3L AAV Vector (Mouse) (CMV)
22338104 1 µg

GNL3L AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Lentiviral mouse Magea5 shRNA (UAS) - Lentiviral mouse Magea5 shRNA (UAS, RFP) (25)
GTR15126659 1 Vial

Lentiviral mouse Magea5 shRNA (UAS) - Lentiviral mouse Magea5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Phospho-eNOS (Thr495) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-3731R-BF680-01 20 µL

Phospho-eNOS (Thr495) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Phospho-eNOS (Thr495) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-3731R-BF680-02 100 µL

Phospho-eNOS (Thr495) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
p16-INK4a (Phospho-Ser152) Antibody
MBS8585374-01 0.1 mg

p16-INK4a (Phospho-Ser152) Antibody

Sign In for Pricing
View Details
p16-INK4a (Phospho-Ser152) Antibody
MBS8585374-02 0.1 mL (AF405L)

p16-INK4a (Phospho-Ser152) Antibody

Sign In for Pricing
View Details