Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gpx7 Rabbit Polyclonal Antibody (Biotin)

Gpx7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

D3ZQI1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Gpx7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001100143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Noc4l shRNA (UAS) - Lentiviral mouseNoc4l shRNA (UAS, GFP) (25)
GTR15179864 1 Vial

Lentiviral mouse Noc4l shRNA (UAS) - Lentiviral mouseNoc4l shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Recombinant Nostoc sp. Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)
MBS1393264-01 0.02 mg (E-Coli)

Recombinant Nostoc sp. Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)

Sign In for Pricing
View Details
Recombinant Nostoc sp. Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)
MBS1393264-02 0.02 mg (Yeast)

Recombinant Nostoc sp. Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)

Sign In for Pricing
View Details
Recombinant Nostoc sp. Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)
MBS1393264-03 0.1 mg (E-Coli)

Recombinant Nostoc sp. Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)

Sign In for Pricing
View Details
Recombinant Nostoc sp. Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)
MBS1393264-04 0.1 mg (Yeast)

Recombinant Nostoc sp. Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)

Sign In for Pricing
View Details
Recombinant Nostoc sp. Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)
MBS1393264-05 0.02 mg (Baculovirus)

Recombinant Nostoc sp. Glutamyl-tRNA (Gln) amidotransferase subunit A (gatA)

Sign In for Pricing
View Details