Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gpx7 Rabbit Polyclonal Antibody (HRP)

Gpx7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

D3ZQI1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Gpx7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001100143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taf7l Mouse Gene Knockout Kit (CRISPR)
KN517154 1 Kit

Taf7l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human RBM41 activation kit by CRISPRa
GA110673 1 Kit

Human RBM41 activation kit by CRISPRa

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1739), CF594 conjugate, 0.1mg/mL
BNC941739-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/1739), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3193), CF568 conjugate, 0.1mg/mL
BNC683193-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3193), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H4 Antibody
F52511-0.4ML 0.4 mL

Histone H4 Antibody

Sign In for Pricing
View Details
PAX5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H5]
TA801971BM 100 µL

PAX5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H5]

Sign In for Pricing
View Details