Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gpx7 Rabbit Polyclonal Antibody (HRP)

Gpx7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

D3ZQI1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Gpx7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001100143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Lsm11 activation kit by CRISPRa
GA209186 1 Kit

Mouse Lsm11 activation kit by CRISPRa

Sign In for Pricing
View Details
1M Tris Buffer, pH7.4, Ultra Pure Grade, 1L
PB0852-1L 1 L

1M Tris Buffer, pH7.4, Ultra Pure Grade, 1L

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS509882 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
ALDH2 Rabbit Polyclonal Antibody
R1407-3 100 µL

ALDH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Angiotensin II Type 2 Receptor (AGTR2) (NM_000686) Human Over-expression Lysate
LC400227 20 µg

Angiotensin II Type 2 Receptor (AGTR2) (NM_000686) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Pancreas
CB619065 1 Block

Frozen Tissue Blocks, Pancreas

Sign In for Pricing
View Details