Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf30 Rabbit Polyclonal Antibody (Biotin)

C2orf30 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CIM, HEL117, XTP3-B, C2orf30, CL24936, CL25084, XTP3TPB

UniProt

Q96DZ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C2orf30

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056516

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UIMC1 Rabbit Polyclonal Antibody
E28PN1481 100 µL

UIMC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
F2 Rabbit pAb
E47R1037 100 µL

F2 Rabbit pAb

Sign In for Pricing
View Details
CHO Monoclonal IFN-alpha/beta R1 Antibody (Medarex patent anti-IFNAR-1) - Humanized - (Dry Ice)
NBP3-28805-1mg 1 mg

CHO Monoclonal IFN-alpha/beta R1 Antibody (Medarex patent anti-IFNAR-1) - Humanized - (Dry Ice)

Sign In for Pricing
View Details
Recombinant Human CD30 / TNFRSF8 Protein (His tag)
ARP8497-01 10 µg

Recombinant Human CD30 / TNFRSF8 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CD30 / TNFRSF8 Protein (His tag)
ARP8497-02 50 µg

Recombinant Human CD30 / TNFRSF8 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CD30 / TNFRSF8 Protein (His tag)
ARP8497-03 100 µg

Recombinant Human CD30 / TNFRSF8 Protein (His tag)

Sign In for Pricing
View Details