Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPG Rabbit Polyclonal Antibody (Biotin)

COPG Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

COPG

UniProt

Q9Y678

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human COPG

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057212

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1, Phosphorylated (S147) (CCNB1, CCNB) (MaxLight 750)
MBS6413338-01 0.1 mL

Cyclin B1, Phosphorylated (S147) (CCNB1, CCNB) (MaxLight 750)

Sign In for Pricing
View Details
Cyclin B1, Phosphorylated (S147) (CCNB1, CCNB) (MaxLight 750)
MBS6413338-02 5x 0.1 mL

Cyclin B1, Phosphorylated (S147) (CCNB1, CCNB) (MaxLight 750)

Sign In for Pricing
View Details
CAP1 Antibody
orb1281473 100 µL

CAP1 Antibody

Sign In for Pricing
View Details
SYNE2 (Synaptic Nuclear Envelope Protein 2, Syne-2, Nesprin-2, Nesp2, Nuclear Envelope Spectrin Repeat Protein 2, Nucleus and Actin Connecting Element Protein, Protein NUANCE, NUA, EDMD5, KIAA1011, TROPH)
MBS6008947-01 0.1 mg

SYNE2 (Synaptic Nuclear Envelope Protein 2, Syne-2, Nesprin-2, Nesp2, Nuclear Envelope Spectrin Repeat Protein 2, Nucleus and Actin Connecting Element Protein, Protein NUANCE, NUA, EDMD5, KIAA1011, TROPH)

Sign In for Pricing
View Details
SYNE2 (Synaptic Nuclear Envelope Protein 2, Syne-2, Nesprin-2, Nesp2, Nuclear Envelope Spectrin Repeat Protein 2, Nucleus and Actin Connecting Element Protein, Protein NUANCE, NUA, EDMD5, KIAA1011, TROPH)
MBS6008947-02 5x 0.1 mg

SYNE2 (Synaptic Nuclear Envelope Protein 2, Syne-2, Nesprin-2, Nesp2, Nuclear Envelope Spectrin Repeat Protein 2, Nucleus and Actin Connecting Element Protein, Protein NUANCE, NUA, EDMD5, KIAA1011, TROPH)

Sign In for Pricing
View Details
Phospho-PTEN (Ser380) Recombinant Rabbit mAb
E43S43182 100 µL

Phospho-PTEN (Ser380) Recombinant Rabbit mAb

Sign In for Pricing
View Details