Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF2 Rabbit Polyclonal Antibody (FITC)

GDF2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BMP9, HHT5, BMP-9

UniProt

Q9UK05

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GDF2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057288

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC5AC (Apomucin Major Airway GlycoProtein, Mucin 5 subtype AC tracheobronchial, Mucin 5 Subtypes A And C, Mucin 5AC oligomeric mucus/gel forming, Tracheobronchial Mucin, TBM, Mucin 5AC, Gastric Mucin) (MaxLight 405)
MBS6193655-01 0.1 mL

MUC5AC (Apomucin Major Airway GlycoProtein, Mucin 5 subtype AC tracheobronchial, Mucin 5 Subtypes A And C, Mucin 5AC oligomeric mucus/gel forming, Tracheobronchial Mucin, TBM, Mucin 5AC, Gastric Mucin) (MaxLight 405)

Sign In for Pricing
View Details
MUC5AC (Apomucin Major Airway GlycoProtein, Mucin 5 subtype AC tracheobronchial, Mucin 5 Subtypes A And C, Mucin 5AC oligomeric mucus/gel forming, Tracheobronchial Mucin, TBM, Mucin 5AC, Gastric Mucin) (MaxLight 405)
MBS6193655-02 5x 0.1 mL

MUC5AC (Apomucin Major Airway GlycoProtein, Mucin 5 subtype AC tracheobronchial, Mucin 5 Subtypes A And C, Mucin 5AC oligomeric mucus/gel forming, Tracheobronchial Mucin, TBM, Mucin 5AC, Gastric Mucin) (MaxLight 405)

Sign In for Pricing
View Details
XRCC2 Rabbit Polyclonal Antibody (BF750)
orb2380993 100 µL

XRCC2 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Recombinant Murine TNF-related apoptosis-inducing Ligand/TNFSF10
P1342-.5 500 µg

Recombinant Murine TNF-related apoptosis-inducing Ligand/TNFSF10

Sign In for Pricing
View Details
Debio-1347 (S) -hydroxysuccinate
T31271-01 100 mg

Debio-1347 (S) -hydroxysuccinate

Sign In for Pricing
View Details
Debio-1347 (S) -hydroxysuccinate
T31271-02 500 mg

Debio-1347 (S) -hydroxysuccinate

Sign In for Pricing
View Details