Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF2 Rabbit Polyclonal Antibody (HRP)

GDF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BMP9, HHT5, BMP-9

UniProt

Q9UK05

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GDF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057288

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

WFDC12, CT (WFDC12, C20orf122, WAP2, WAP four-disulfide core domain protein 12, Putative protease inhibitor WAP12, Whey acidic protein 2) (APC) discontinued
043869-APC 200 µL

WFDC12, CT (WFDC12, C20orf122, WAP2, WAP four-disulfide core domain protein 12, Putative protease inhibitor WAP12, Whey acidic protein 2) (APC) discontinued

Sign In for Pricing
View Details
Rat Solute Carrier Family 7, Member 11 (SLC7A11; CCBR1) ELISA Kit
YP-W39268-01 48 Tests

Rat Solute Carrier Family 7, Member 11 (SLC7A11; CCBR1) ELISA Kit

Sign In for Pricing
View Details
Rat Solute Carrier Family 7, Member 11 (SLC7A11; CCBR1) ELISA Kit
YP-W39268-02 96 Tests

Rat Solute Carrier Family 7, Member 11 (SLC7A11; CCBR1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human RSRC1 Protein
E30P8146 20 µg

Recombinant Human RSRC1 Protein

Sign In for Pricing
View Details
SARS Associated Coronavirus Nucleocaspid, Recombinant, aa340-390 discontinued
209190 100 µg

SARS Associated Coronavirus Nucleocaspid, Recombinant, aa340-390 discontinued

Sign In for Pricing
View Details
Mouse Kbtbd13 Pre-designed siRNA Set A
SI106994A 1 Each

Mouse Kbtbd13 Pre-designed siRNA Set A

Sign In for Pricing
View Details