Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE7B Rabbit Polyclonal Antibody (Biotin)

PDE7B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BA472E5.1

UniProt

Q9NP56

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PDE7B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061818

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smoc1 (NM_022316) Mouse Tagged ORF Clone
MR207219 10 µg

Smoc1 (NM_022316) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human TMEM97 Protein, N-His-SUMO
E55P5880 50 µg

Recombinant Human TMEM97 Protein, N-His-SUMO

Sign In for Pricing
View Details
ERK1 Rabbit pAb
E45R19934N-50 50 µL

ERK1 Rabbit pAb

Sign In for Pricing
View Details
TLE1, ID (TLE1, Transducin-like enhancer protein 1, E(Sp1) homolog, Enhancer of split groucho-like protein 1) (MaxLight 405)
MBS6188646-01 0.1 mL

TLE1, ID (TLE1, Transducin-like enhancer protein 1, E(Sp1) homolog, Enhancer of split groucho-like protein 1) (MaxLight 405)

Sign In for Pricing
View Details
TLE1, ID (TLE1, Transducin-like enhancer protein 1, E(Sp1) homolog, Enhancer of split groucho-like protein 1) (MaxLight 405)
MBS6188646-02 5x 0.1 mL

TLE1, ID (TLE1, Transducin-like enhancer protein 1, E(Sp1) homolog, Enhancer of split groucho-like protein 1) (MaxLight 405)

Sign In for Pricing
View Details
ARMC12 Protein Vector (Human) (pPM-C-HA)
12409021 500 ng

ARMC12 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details