Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELP4 Rabbit Polyclonal Antibody (HRP)

ELP4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AN, AN2, hELP4, PAXNEB, PAX6NEB, C11orf19, dJ68P15A.1

UniProt

Q96EB1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELP4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human VLDLR/VLDL Receptor Protein (His Tag)
PKSH031275 100 µg

Recombinant Human VLDLR/VLDL Receptor Protein (His Tag)

Sign In for Pricing
View Details
SH3BGR Mouse Monoclonal Antibody [Clone ID: OTI1G8]
CF812046 100 µg

SH3BGR Mouse Monoclonal Antibody [Clone ID: OTI1G8]

Sign In for Pricing
View Details
C-Fos Recombinant Chimeric Antibody Antibody
HA610220 100 µg

C-Fos Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
NPM1 Antibody (Biotin)
KB-8030-01 50 μL

NPM1 Antibody (Biotin)

Sign In for Pricing
View Details
NPM1 Antibody (Biotin)
KB-8030-02 100 µL

NPM1 Antibody (Biotin)

Sign In for Pricing
View Details
NPM1 Antibody (Biotin)
KB-8030-03 1 mL

NPM1 Antibody (Biotin)

Sign In for Pricing
View Details