Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF21 Rabbit Polyclonal Antibody (FITC)

FGF21 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9NSA1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FGF21

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_061986

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDOA (Fructose-bisphosphate Aldolase A, Lung Cancer Antigen NY-LU-1, Muscle-type Aldolase, ALDA) (Biotin)
123223-Biotin 100 µL

ALDOA (Fructose-bisphosphate Aldolase A, Lung Cancer Antigen NY-LU-1, Muscle-type Aldolase, ALDA) (Biotin)

Sign In for Pricing
View Details
Rat Phosphorylation Signal Transducer And Activator Of Transcription 3 (p-STAT3) ELISA Kit
orb2810311-01 48 Tests

Rat Phosphorylation Signal Transducer And Activator Of Transcription 3 (p-STAT3) ELISA Kit

Sign In for Pricing
View Details
Rat Phosphorylation Signal Transducer And Activator Of Transcription 3 (p-STAT3) ELISA Kit
orb2810311-02 96 Tests

Rat Phosphorylation Signal Transducer And Activator Of Transcription 3 (p-STAT3) ELISA Kit

Sign In for Pricing
View Details
Rat Phosphorylation Signal Transducer And Activator Of Transcription 3 (p-STAT3) ELISA Kit
orb2810311-03 5 x 96 T

Rat Phosphorylation Signal Transducer And Activator Of Transcription 3 (p-STAT3) ELISA Kit

Sign In for Pricing
View Details
Elovl5 3'UTR GFP Stable Cell Line
TU155778 1.0 mL

Elovl5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
OR1M4P Recombinant Protein (Human)
RP079749 100 µg

OR1M4P Recombinant Protein (Human)

Sign In for Pricing
View Details