Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKIRAS1 Rabbit Polyclonal Antibody (FITC)

NKIRAS1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KBRAS1, kappaB-Ras1

UniProt

Q9NYS0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NKIRAS1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065078

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phostensin (PPP1R18) activation kit by CRISPRa
GA116228 1 Kit

Human Phostensin (PPP1R18) activation kit by CRISPRa

Sign In for Pricing
View Details
Wdyhv1 (NM_029734) Mouse Tagged ORF Clone
MG202245 10 µg

Wdyhv1 (NM_029734) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
POTEG Mouse Monoclonal Antibody [Clone ID: OTI2G1]
CF808095 100 µg

POTEG Mouse Monoclonal Antibody [Clone ID: OTI2G1]

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2617), Biotin conjugate, 0.1mg/mL
BNCB2617-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2617), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cathepsin D (Tumor Marker) (CTSD/3082), CF568 conjugate, 0.1mg/mL
BNC683082-500 1x 500 µL

Cathepsin D (Tumor Marker) (CTSD/3082), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF740 conjugate, 0.1mg/mL
BNC741805-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details