Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKIRAS1 Rabbit Polyclonal Antibody (FITC)

NKIRAS1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KBRAS1, kappaB-Ras1

UniProt

Q9NYS0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NKIRAS1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065078

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), Biotin conjugate, 0.1mg/mL
BNCB1731-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat COL4 (Collagen Type IV) CLIA Kit
E-CL-R0162-01 24 Tests

Rat COL4 (Collagen Type IV) CLIA Kit

Sign In for Pricing
View Details
Rat COL4 (Collagen Type IV) CLIA Kit
E-CL-R0162-02 48 Tests

Rat COL4 (Collagen Type IV) CLIA Kit

Sign In for Pricing
View Details
Rat COL4 (Collagen Type IV) CLIA Kit
E-CL-R0162-03 96 Tests

Rat COL4 (Collagen Type IV) CLIA Kit

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPPL2) Rabbit Polyclonal Antibody
TA373476 100 µL

Alkaline Phosphatase (ALPPL2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MARK2 (Ab-596) Antibody
8B1094-AAT 50 µg

MARK2 (Ab-596) Antibody

Sign In for Pricing
View Details