Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKIRAS1 Rabbit Polyclonal Antibody (HRP)

NKIRAS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KBRAS1, kappaB-Ras1

UniProt

Q9NYS0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NKIRAS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065078

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RYK (NM_002958) Human Recombinant Protein
TP315509L 1 mg

RYK (NM_002958) Human Recombinant Protein

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/2887R), CF740 conjugate, 0.1mg/mL
BNC742887-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/2887R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lipoxygenase (LOX) Activity Assay Kit
E-BC-K861-M-01 48 T (46 samples)

Lipoxygenase (LOX) Activity Assay Kit

Sign In for Pricing
View Details
Lipoxygenase (LOX) Activity Assay Kit
E-BC-K861-M-02 96 T (94 samples)

Lipoxygenase (LOX) Activity Assay Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS624957 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
(3aR,4R,5R,6aS)-4-[3-(Ethyleneketal)decanyl]hexahydro-5-hydroxy-2H-cyclopenta[b]furan-2-one 5-(4-Phenylbenzoate)-d15
TRC-E917802-25MG 25 mg

(3aR,4R,5R,6aS)-4-[3-(Ethyleneketal)decanyl]hexahydro-5-hydroxy-2H-cyclopenta[b]furan-2-one 5-(4-Phenylbenzoate)-d15

Sign In for Pricing
View Details