Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA7 Rabbit Polyclonal Antibody (HRP)

IFNA7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IFNA-J, IFN-alphaJ

UniProt

P01567

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IFNA7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_066401

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS716741 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Desmin (DES) Rabbit Polyclonal Antibody
AP06608PU-N 100 µg

Desmin (DES) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Spinorphin TFA Salt
TRC-S681958-2.5MG 2.5 mg

Spinorphin TFA Salt

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD45RO Antibody[UCHL1]
E-AB-F1139P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD45RO Antibody[UCHL1]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD45RO Antibody[UCHL1]
E-AB-F1139P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD45RO Antibody[UCHL1]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD45RO Antibody[UCHL1]
E-AB-F1139P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Human CD45RO Antibody[UCHL1]

Sign In for Pricing
View Details