Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA2 Rabbit Polyclonal Antibody (Biotin)

HSPA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSP70-2, HSP70-3

UniProt

P54652

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HSPA2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068814

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogenic Coliform Agar (CCA - acc. to ISO 9308)
TMB_CCA_P60_10 1 Each

Chromogenic Coliform Agar (CCA - acc. to ISO 9308)

Sign In for Pricing
View Details
ATP13A2 Knockout Hela Polyclonal Cells
ARG20959 1 Million

ATP13A2 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
CCND1 (BCL1) gene amplification probe
FP-041 1 Vial 100 μL (10-20 T)

CCND1 (BCL1) gene amplification probe

Sign In for Pricing
View Details
Grb2 (Growth Factor Receptor-Bound Protein 2, ASH, Abundant Src Homology) (PE)
MBS6244193-01 0.1 mL

Grb2 (Growth Factor Receptor-Bound Protein 2, ASH, Abundant Src Homology) (PE)

Sign In for Pricing
View Details
Grb2 (Growth Factor Receptor-Bound Protein 2, ASH, Abundant Src Homology) (PE)
MBS6244193-02 5x 0.1 mL

Grb2 (Growth Factor Receptor-Bound Protein 2, ASH, Abundant Src Homology) (PE)

Sign In for Pricing
View Details
CCS1 Antibody
orb845030 2 mg

CCS1 Antibody

Sign In for Pricing
View Details