Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C11orf67 Rabbit Polyclonal Antibody (FITC)

C11orf67 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CK067, PTD015, C11orf67

UniProt

Q9H7C9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C11orf67

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078960

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-West Nile Virus (WNV) (lineage 1, strain NY99) E/Envelope Polyclonal Antibody
E-AB-V1322-01 20 µL

Anti-West Nile Virus (WNV) (lineage 1, strain NY99) E/Envelope Polyclonal Antibody

Sign In for Pricing
View Details
Anti-West Nile Virus (WNV) (lineage 1, strain NY99) E/Envelope Polyclonal Antibody
E-AB-V1322-02 100 µL

Anti-West Nile Virus (WNV) (lineage 1, strain NY99) E/Envelope Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707830 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Indo-1, AM *UltraPure Grade* *CAS 112926-02-0*
21036-AAT 20x 50 µg

Indo-1, AM *UltraPure Grade* *CAS 112926-02-0*

Sign In for Pricing
View Details
MRP3 (Multidrug Resistance-Associated Protein 3) (ABCC3/2971), CF568 conjugate, 0.1mg/mL
BNC682971-100 1x 100 µL

MRP3 (Multidrug Resistance-Associated Protein 3) (ABCC3/2971), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Apoptosis repressor with CARD (NOL3) (NM_001185057) Human Recombinant Protein
TP720132L 500 µg

Apoptosis repressor with CARD (NOL3) (NM_001185057) Human Recombinant Protein

Sign In for Pricing
View Details