Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABRAXAS2 Rabbit Polyclonal Antibody (FITC)

ABRAXAS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ABRO1, FAM175B, KIAA0157

UniProt

Q15018

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIAA0157

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPDEDPRNTQTSQI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115558

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB B220, CD45R, GP180, Leukocyte common antigen (LCA), Loc, Ly-5, Lyt-4, Protein tyrosine phosphatase receptor type C (PTPRC), Receptor-type tyrosine-protein phosphatase C, T200 glycoprotein (BSA & Azide Free)
168699-AF 100 µg

CD45RB B220, CD45R, GP180, Leukocyte common antigen (LCA), Loc, Ly-5, Lyt-4, Protein tyrosine phosphatase receptor type C (PTPRC), Receptor-type tyrosine-protein phosphatase C, T200 glycoprotein (BSA & Azide Free)

Sign In for Pricing
View Details
Recombinant Human IGF2 Protein
ARP2574-01 10 µg

Recombinant Human IGF2 Protein

Sign In for Pricing
View Details
Recombinant Human IGF2 Protein
ARP2574-02 50 µg

Recombinant Human IGF2 Protein

Sign In for Pricing
View Details
Recombinant Human IGF2 Protein
ARP2574-03 100 µg

Recombinant Human IGF2 Protein

Sign In for Pricing
View Details
Recombinant Human IGF2 Protein
ARP2574-04 1 mg

Recombinant Human IGF2 Protein

Sign In for Pricing
View Details
SPHK2 (Sphingosine Kinase 2)
252044 100 µL

SPHK2 (Sphingosine Kinase 2)

Sign In for Pricing
View Details