Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRAS Rabbit Polyclonal Antibody (Biotin)

KRAS Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NS, NS3, OES, CFC2, RALD, K-Ras, KRAS1, KRAS2, RASK2, KI-RAS, C-K-RAS, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, K-Ras 2, 'C-K-RAS, c-Ki-ras, c-Ki-ras2

UniProt

P01111

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KRAS

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_203524

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIAT4A (ST3GAL1) (NM_003033) Human Tagged ORF Clone Lentiviral Particle
RC217696L3V 200 µL

SIAT4A (ST3GAL1) (NM_003033) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TGM4 Polyclonal Antibody
ABP60670-01 30 µL

TGM4 Polyclonal Antibody

Sign In for Pricing
View Details
TGM4 Polyclonal Antibody
ABP60670-02 100 µL

TGM4 Polyclonal Antibody

Sign In for Pricing
View Details
TGM4 Polyclonal Antibody
ABP60670-03 200 µL

TGM4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Mouse Protein disulfide-isomerase A2 (PDIA2) antibody
PDIM21-A 100 µg

Rabbit anti-Mouse Protein disulfide-isomerase A2 (PDIA2) antibody

Sign In for Pricing
View Details
NFATC3 polyclonal antibody
BS71918-01 50 µL

NFATC3 polyclonal antibody

Sign In for Pricing
View Details