Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRAS Rabbit Polyclonal Antibody (HRP)

KRAS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NS, NS3, OES, CFC2, RALD, K-Ras, KRAS1, KRAS2, RASK2, KI-RAS, C-K-RAS, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, K-Ras 2, 'C-K-RAS, c-Ki-ras, c-Ki-ras2

UniProt

P01111

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KRAS

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_203524

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dlx5 (NM_012943) Rat Tagged ORF Clone
RR205774 10 µg

Dlx5 (NM_012943) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Pop1 ORF Vector (Mouse) (pORF)
37230014 1.0 µg DNA

Pop1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Horse equine GDF5 PicoKine ELISA Kit
MBS1751119-01 96 Well

Horse equine GDF5 PicoKine ELISA Kit

Sign In for Pricing
View Details
Horse equine GDF5 PicoKine ELISA Kit
MBS1751119-02 5x 96 Well

Horse equine GDF5 PicoKine ELISA Kit

Sign In for Pricing
View Details
CLEC4A2 Protein, Rat, Recombinant (His Tag)
PR53638M1 100 µg

CLEC4A2 Protein, Rat, Recombinant (His Tag)

Sign In for Pricing
View Details
Human GPA33, InVivo Block/Neutralizing Antibody
ANT-37345-100ug 100 µg

Human GPA33, InVivo Block/Neutralizing Antibody

Sign In for Pricing
View Details