Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF13 Rabbit Polyclonal Antibody (Biotin)

FGF13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FGF2, FHF2, DEE90, FHF-2, FGF-13, LINC00889

UniProt

Q92913

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FGF13

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004105

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ESR1 Protein Vector (Mouse) (pPM-C-HA)
PV176384 500 ng

ESR1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Usp22 shRNA (UAS) - Lentiviral mouse Usp22 shRNA (UAS) plasmid
GTR15286339 1 Vial

Lentiviral mouse Usp22 shRNA (UAS) - Lentiviral mouse Usp22 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Anti-Cytokeratin 14/KRT14 Antibody, Mouse Monoclonal
MBS8100106-01 0.1 mL

Anti-Cytokeratin 14/KRT14 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-Cytokeratin 14/KRT14 Antibody, Mouse Monoclonal
MBS8100106-02 5x 0.1 mL

Anti-Cytokeratin 14/KRT14 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
M3 glycan (Man3), 2-AA labelled
HY-158483 1 Each

M3 glycan (Man3), 2-AA labelled

Sign In for Pricing
View Details
CBL-C, NT (Signal Transduction Protein CBL-C, SH3-binding Protein CBL-C, SH3-binding Protein CBL-3, CBL3, RING Finger Protein 57, RNF57) (AP)
MBS6466260-01 0.2 mL

CBL-C, NT (Signal Transduction Protein CBL-C, SH3-binding Protein CBL-C, SH3-binding Protein CBL-3, CBL3, RING Finger Protein 57, RNF57) (AP)

Sign In for Pricing
View Details