Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF13 Rabbit Polyclonal Antibody (HRP)

FGF13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FGF2, FHF2, DEE90, FHF-2, FGF-13, LINC00889

UniProt

Q92913

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FGF13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004105

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF747 siRNA
abx941064-01 15 nmol

Human ZNF747 siRNA

Sign In for Pricing
View Details
Human ZNF747 siRNA
abx941064-02 30 nmol

Human ZNF747 siRNA

Sign In for Pricing
View Details
Uhrf2 (E3 Ubiquitin-Protein Ligase UHRF2, 632-, NIRF, Np95-like ring Finger Protein, Nuclear Protein 97, Nuclear Zinc Finger Protein Np97, Ubiquitin-like PHD and RING Finger Domain-Containing Protein 2, Ubiquitin-like-Containing PHD and RING Finger Domain
MBS6460097-01 0.1 mL

Uhrf2 (E3 Ubiquitin-Protein Ligase UHRF2, 632-, NIRF, Np95-like ring Finger Protein, Nuclear Protein 97, Nuclear Zinc Finger Protein Np97, Ubiquitin-like PHD and RING Finger Domain-Containing Protein 2, Ubiquitin-like-Containing PHD and RING Finger Domain

Sign In for Pricing
View Details
Uhrf2 (E3 Ubiquitin-Protein Ligase UHRF2, 632-, NIRF, Np95-like ring Finger Protein, Nuclear Protein 97, Nuclear Zinc Finger Protein Np97, Ubiquitin-like PHD and RING Finger Domain-Containing Protein 2, Ubiquitin-like-Containing PHD and RING Finger Domain
MBS6460097-02 5x 0.1 mL

Uhrf2 (E3 Ubiquitin-Protein Ligase UHRF2, 632-, NIRF, Np95-like ring Finger Protein, Nuclear Protein 97, Nuclear Zinc Finger Protein Np97, Ubiquitin-like PHD and RING Finger Domain-Containing Protein 2, Ubiquitin-like-Containing PHD and RING Finger Domain

Sign In for Pricing
View Details
SETDB1 (NM_012432) Human Mass Spec Standard
PH303647 10 µg

SETDB1 (NM_012432) Human Mass Spec Standard

Sign In for Pricing
View Details
Human Special AT-rich sequence-Binding Protein 2 (SATB2) ELISA Kit
orb867001-01 48 Tests

Human Special AT-rich sequence-Binding Protein 2 (SATB2) ELISA Kit

Sign In for Pricing
View Details