Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOM-TES-103 Rabbit Polyclonal Antibody (Biotin)

HOM-TES-103 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IFFO, HOM-TES-103

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HOM-TES-103

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_542769

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat PKBb (Protein Kinase B Beta) ELISA Kit
ELK6721-01 48 Tests

Rat PKBb (Protein Kinase B Beta) ELISA Kit

Sign In for Pricing
View Details
Rat PKBb (Protein Kinase B Beta) ELISA Kit
ELK6721-02 96 Tests

Rat PKBb (Protein Kinase B Beta) ELISA Kit

Sign In for Pricing
View Details
Rat PKBb (Protein Kinase B Beta) ELISA Kit
ELK6721-03 5x 96 Tests

Rat PKBb (Protein Kinase B Beta) ELISA Kit

Sign In for Pricing
View Details
MCM2 Mouse Monoclonal Antibody [Clone U mLBI238]
E45M21974V-2 50 µL

MCM2 Mouse Monoclonal Antibody [Clone U mLBI238]

Sign In for Pricing
View Details
Mrgprg sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3236308 1.0 µg DNA

Mrgprg sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
CFTR Polyclonal Antibody
MBS9413555-01 0.05 mL

CFTR Polyclonal Antibody

Sign In for Pricing
View Details