Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bin1 Rabbit Polyclonal Antibody (Biotin)

Bin1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Am, ALP-1, Amphl, SH3P9, BRAMP-2

UniProt

O08539

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PVPPPPKHTPSKEMKQEQILSLFDDAFVPEISVTTPSQFEAPGPFSEQAS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033798

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SPTSSA Pre-designed siRNA Set A
SI015746A 1 Each

Human SPTSSA Pre-designed siRNA Set A

Sign In for Pricing
View Details
PCAF (K (Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (HRP)
249813-HRP 100 µL

PCAF (K (Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (HRP)

Sign In for Pricing
View Details
PPP1R7 Rabbit Polyclonal Antibody
orb214426-01 30 µL

PPP1R7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R7 Rabbit Polyclonal Antibody
orb214426-02 50 μL

PPP1R7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R7 Rabbit Polyclonal Antibody
orb214426-03 100 µL

PPP1R7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R7 Rabbit Polyclonal Antibody
orb214426-04 200 µL

PPP1R7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details