Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ska1 Rabbit Polyclonal Antibody (HRP)

Ska1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AV117428, 2810433K01Rik

UniProt

Q9CPV1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLNKFELEIQYQEQTNSSLKELCESLREECEDVEHLKEHVPPHLPQVTAT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079857

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Transcriptional regulator ERG (ERG) ELISA Kit
abx522264 96 Tests

Mouse Transcriptional regulator ERG (ERG) ELISA Kit

Sign In for Pricing
View Details
Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-21, chloroplastic (LHC Ib-21)
orb2929353-01 20 µg

Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-21, chloroplastic (LHC Ib-21)

Sign In for Pricing
View Details
Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-21, chloroplastic (LHC Ib-21)
orb2929353-02 100 µg

Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-21, chloroplastic (LHC Ib-21)

Sign In for Pricing
View Details
SNX5 Protein Lysate (Mouse) with C-HA Tag
45083034 100 µg

SNX5 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
ETV4, CT (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (AP)
MBS6475088-01 0.2 mL

ETV4, CT (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (AP)

Sign In for Pricing
View Details
ETV4, CT (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (AP)
MBS6475088-02 5x 0.2 mL

ETV4, CT (ETS Translocation Variant 4, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, Adenovirus E1A Enhancer-binding Protein, E1A-F, E1AF) (AP)

Sign In for Pricing
View Details