Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apbb1 Rabbit Polyclonal Antibody (HRP)

Apbb1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rir, Fe65

UniProt

Q9QXJ1

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033815

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPCAT1 Rabbit mAb
orb1564664-01 20 ul

LPCAT1 Rabbit mAb

Sign In for Pricing
View Details
LPCAT1 Rabbit mAb
orb1564664-02 50 µL

LPCAT1 Rabbit mAb

Sign In for Pricing
View Details
LPCAT1 Rabbit mAb
orb1564664-03 100 µL

LPCAT1 Rabbit mAb

Sign In for Pricing
View Details
Myosin-3 Rabbit Polyclonal Antibody (RBITC)
orb1068678 100 µL

Myosin-3 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Goat Bovine IgG (heavy and light chains), conjugated with Horseradish peroxidase Antibody
orb22027 1 mL

Goat Bovine IgG (heavy and light chains), conjugated with Horseradish peroxidase Antibody

Sign In for Pricing
View Details
Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)
372969-01 20 µg

Cystathionine beta-Synthase, Recombinant, Mouse, aa2-561, His-Tag (Cbs)

Sign In for Pricing
View Details