Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGMS1 Rabbit Polyclonal Antibody (Biotin)

SGMS1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MOB, MOB1, SMS1, TMEM23, hmob33

UniProt

Q86VZ5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SGMS1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_671512

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FXN Antibody / Frataxin
V3992-100UG 100 µg

FXN Antibody / Frataxin

Sign In for Pricing
View Details
TSC22D4 (TSC22 Domain Family Protein 4, Tsc-22-like Protein THG-1, THG1, THG-1, TSC22-related-inducible Leucine Zipper Protein 2, TILZ2) (MaxLight 405) discontinued
134804-ML405 100 µL

TSC22D4 (TSC22 Domain Family Protein 4, Tsc-22-like Protein THG-1, THG1, THG-1, TSC22-related-inducible Leucine Zipper Protein 2, TILZ2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Ppig shRNA (UAS) - Lentiviral mouse Ppig shRNA (UAS) (25)
GTR15165221 1 Vial

Lentiviral mouse Ppig shRNA (UAS) - Lentiviral mouse Ppig shRNA (UAS) (25)

Sign In for Pricing
View Details
CDRT4, ID (CDRT4, CMT1A duplicated region transcript 4 protein) (FITC) discontinued
033725-FITC 200 µL

CDRT4, ID (CDRT4, CMT1A duplicated region transcript 4 protein) (FITC) discontinued

Sign In for Pricing
View Details
Wash2 Recombinant Protein (Rat)
RP237161 100 µg

Wash2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Fmoc-9-aminononanoic acid
T69887-01 25 mg

Fmoc-9-aminononanoic acid

Sign In for Pricing
View Details