Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf25 Rabbit Polyclonal Antibody (HRP)

C9orf25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C9orf25

UniProt

Q8IW50

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C9orf25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_671735

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FYN Knockout AGS Polyclonal Cells
ARG3222 1 Million

FYN Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
T150A, ID (TMEM150A, TMEM150, Transmembrane protein 150A, Transmembrane protein 150) (MaxLight 405)
MBS6353154-01 0.1 mL

T150A, ID (TMEM150A, TMEM150, Transmembrane protein 150A, Transmembrane protein 150) (MaxLight 405)

Sign In for Pricing
View Details
T150A, ID (TMEM150A, TMEM150, Transmembrane protein 150A, Transmembrane protein 150) (MaxLight 405)
MBS6353154-02 5x 0.1 mL

T150A, ID (TMEM150A, TMEM150, Transmembrane protein 150A, Transmembrane protein 150) (MaxLight 405)

Sign In for Pricing
View Details
Human Zinc finger protein 281 Protein
orb1475620-01 50 µg

Human Zinc finger protein 281 Protein

Sign In for Pricing
View Details
Human Zinc finger protein 281 Protein
orb1475620-02 500 µg

Human Zinc finger protein 281 Protein

Sign In for Pricing
View Details
UBE2B, CT (Ubiquitin-conjugating Enzyme E2 B, Ubiquitin-protein Ligase B, Ubiquitin Carrier Protein B, RAD6 Homolog B, HR6B, Ubiquitin-conjugating Enzyme E2-17kD, RAD6B) (MaxLight 490)
MBS6504370-01 0.1 mL

UBE2B, CT (Ubiquitin-conjugating Enzyme E2 B, Ubiquitin-protein Ligase B, Ubiquitin Carrier Protein B, RAD6 Homolog B, HR6B, Ubiquitin-conjugating Enzyme E2-17kD, RAD6B) (MaxLight 490)

Sign In for Pricing
View Details