Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCAPH2 Rabbit Polyclonal Antibody (HRP)

NCAPH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAPH2

UniProt

Q6IBW4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NCAPH2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689512

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GM2A Antibody [DyLight 594]
NBP3-00106DL594 0.1 mL

Rabbit Polyclonal GM2A Antibody [DyLight 594]

Sign In for Pricing
View Details
HOOK2 (Protein Hook Homolog 2, h-hook2, hHK2, FLJ26218) (MaxLight 750) discontinued
128000-ML750 100 µL

HOOK2 (Protein Hook Homolog 2, h-hook2, hHK2, FLJ26218) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CD41 discontinued
516367-01 25 µg

CD41 discontinued

Sign In for Pricing
View Details
CD41 discontinued
516367-02 100 µg

CD41 discontinued

Sign In for Pricing
View Details
5-HT3E Recombinant Protein Antigen
NBP2-33578PEP 0.1 mL

5-HT3E Recombinant Protein Antigen

Sign In for Pricing
View Details
MFSD6, CT (MFSD6, MMR2, Major facilitator superfamily domain-containing protein 6, Macrophage MHC class I receptor 2 homolog) (MaxLight 490)
MBS6320597-01 0.1 mL

MFSD6, CT (MFSD6, MMR2, Major facilitator superfamily domain-containing protein 6, Macrophage MHC class I receptor 2 homolog) (MaxLight 490)

Sign In for Pricing
View Details