Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCAPH2 Rabbit Polyclonal Antibody (FITC)

NCAPH2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CAPH2

UniProt

Q6IBW4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NCAPH2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689512

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEA8 (Melanoma-associated Antigen 8, MAGE-8 Antigen, Cancer/Testis Antigen 1.8, CT1.8, MAGE8, MGC2182) (MaxLight 405)
MBS6384614-01 0.1 mL

MAGEA8 (Melanoma-associated Antigen 8, MAGE-8 Antigen, Cancer/Testis Antigen 1.8, CT1.8, MAGE8, MGC2182) (MaxLight 405)

Sign In for Pricing
View Details
MAGEA8 (Melanoma-associated Antigen 8, MAGE-8 Antigen, Cancer/Testis Antigen 1.8, CT1.8, MAGE8, MGC2182) (MaxLight 405)
MBS6384614-02 5x 0.1 mL

MAGEA8 (Melanoma-associated Antigen 8, MAGE-8 Antigen, Cancer/Testis Antigen 1.8, CT1.8, MAGE8, MGC2182) (MaxLight 405)

Sign In for Pricing
View Details
Anti-SLC39A10 Antibody Picoband®, Dylight550 Conjugate
A09043-1-Dylight550 100 µg

Anti-SLC39A10 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) ELISA Kit
MBS452716-01 48 Tests

Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) ELISA Kit

Sign In for Pricing
View Details
Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) ELISA Kit
MBS452716-02 96 Tests

Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) ELISA Kit

Sign In for Pricing
View Details
Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) ELISA Kit
MBS452716-03 5x 96 Tests

Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) ELISA Kit

Sign In for Pricing
View Details