Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam123a Rabbit Polyclonal Antibody (Biotin)

Fam123a Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ame, Fam12, Fam123a, 2600011E07Rik

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DSHCECAAETPAAEPPSGKINKAAFKLFKKRKSGGTMPSIFGVKNKGDGK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFBR2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
46596156 3x 1.0 µg DNA

TGFBR2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
TCEAL6 Antibody
ABD4571 100 µg

TCEAL6 Antibody

Sign In for Pricing
View Details
BCL2L1 Recombinant Protein
OPCA01483-100UG 100 µg

BCL2L1 Recombinant Protein

Sign In for Pricing
View Details
Bovine N-glycosylase/DNA lyase ELISA Kit
GTR10455766 96 Well

Bovine N-glycosylase/DNA lyase ELISA Kit

Sign In for Pricing
View Details
AARS Rabbit Polyclonal Antibody
MBS9465182-01 0.05 mL

AARS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AARS Rabbit Polyclonal Antibody
MBS9465182-02 0.1 mL

AARS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details