Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam123a Rabbit Polyclonal Antibody (HRP)

Fam123a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ame, Fam12, Fam123a, 2600011E07Rik

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DSHCECAAETPAAEPPSGKINKAAFKLFKKRKSGGTMPSIFGVKNKGDGK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpr89b (NM_001139486) Rat Untagged Clone
RN213252 10 µg

Gpr89b (NM_001139486) Rat Untagged Clone

Sign In for Pricing
View Details
C3ORF31 (TAMM41) (NM_138807) Human Tagged Lenti ORF Clone
RC203634L4 10 µg

C3ORF31 (TAMM41) (NM_138807) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MOB3B Rabbit pAb
E2163866 100 µL

MOB3B Rabbit pAb

Sign In for Pricing
View Details
CEBPE Antibody
orb1281430 100 µL

CEBPE Antibody

Sign In for Pricing
View Details
OR4D6 Human shRNA Plasmid Kit (Locus ID 219983)
TR310860 1 Kit

OR4D6 Human shRNA Plasmid Kit (Locus ID 219983)

Sign In for Pricing
View Details
Ccdc144b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4276907 1.0 µg DNA

Ccdc144b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details