Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEPACAM Rabbit Polyclonal Antibody (Biotin)

HEPACAM Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1306811

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1306811

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ALRLSPFVYLLLIQPVPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_002727080

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPC3 Rabbit Polyclonal Antibody
orb576371 100 µL

GPC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MCH-2R (Melanin-Concentrating Hormone Receptor 2, MCH Receptor 2, MCH-R2, MCHR-2, G-Protein Coupled Receptor 145, GPRv17, MCH-2R, MCH2, MCH2R, MCHR2, GPR145, SLT) discontinued
224051-01 50 µL

MCH-2R (Melanin-Concentrating Hormone Receptor 2, MCH Receptor 2, MCH-R2, MCHR-2, G-Protein Coupled Receptor 145, GPRv17, MCH-2R, MCH2, MCH2R, MCHR2, GPR145, SLT) discontinued

Sign In for Pricing
View Details
MCH-2R (Melanin-Concentrating Hormone Receptor 2, MCH Receptor 2, MCH-R2, MCHR-2, G-Protein Coupled Receptor 145, GPRv17, MCH-2R, MCH2, MCH2R, MCHR2, GPR145, SLT) discontinued
224051-02 100 µL

MCH-2R (Melanin-Concentrating Hormone Receptor 2, MCH Receptor 2, MCH-R2, MCHR-2, G-Protein Coupled Receptor 145, GPRv17, MCH-2R, MCH2, MCH2R, MCHR2, GPR145, SLT) discontinued

Sign In for Pricing
View Details
Ammonium Fluoride discontinued. See 235298
441426-01 1 g

Ammonium Fluoride discontinued. See 235298

Sign In for Pricing
View Details
Ammonium Fluoride discontinued. See 235298
441426-02 10 g

Ammonium Fluoride discontinued. See 235298

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r202 shRNA (UAS) - Lentiviral mouse Vmn1r202 shRNA (UAS, RFP) plasmid
GTR15155341 1 Vial

Lentiviral mouse Vmn1r202 shRNA (UAS) - Lentiviral mouse Vmn1r202 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details