Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5DC1 Rabbit Polyclonal Antibody (Biotin)

NT5DC1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LP2642, NT5C2L1, C6orf200

UniProt

Q5TFE4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NT5DC1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689942

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

A62-2-417 Pre-sized Labels for Printers
152222 550 Roll (550 Label (s) x 1 Roll)

A62-2-417 Pre-sized Labels for Printers

Sign In for Pricing
View Details
DDX6, ID (DDX6, HLR2, RCK, Probable ATP-dependent RNA helicase DDX6, ATP-dependent RNA helicase p54, DEAD box protein 6, Oncogene RCK) (MaxLight 405) discontinued
034564-ML405 100 µL

DDX6, ID (DDX6, HLR2, RCK, Probable ATP-dependent RNA helicase DDX6, ATP-dependent RNA helicase p54, DEAD box protein 6, Oncogene RCK) (MaxLight 405) discontinued

Sign In for Pricing
View Details
SMARCD3 Antibody, HRP conjugated
A58789-100UG 100 µg

SMARCD3 Antibody, HRP conjugated

Sign In for Pricing
View Details
SRp75 Double Nickase Plasmid (h)
sc-401964-NIC 20 µg

SRp75 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
1-Bromo-2- (tert-butyl) -4-methoxybenzene
OR1096883-01 250 mg

1-Bromo-2- (tert-butyl) -4-methoxybenzene

Sign In for Pricing
View Details
1-Bromo-2- (tert-butyl) -4-methoxybenzene
OR1096883-02 500 mg

1-Bromo-2- (tert-butyl) -4-methoxybenzene

Sign In for Pricing
View Details