Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5DC1 Rabbit Polyclonal Antibody (HRP)

NT5DC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LP2642, NT5C2L1, C6orf200

UniProt

Q5TFE4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NT5DC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689942

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Mouse BEST2 Polyclonal Antibody
PA84876MO-01 50 µg

Rabbit Anti-Mouse BEST2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Mouse BEST2 Polyclonal Antibody
PA84876MO-02 100 µg

Rabbit Anti-Mouse BEST2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Mouse BEST2 Polyclonal Antibody
PA84876MO-03 500 µg

Rabbit Anti-Mouse BEST2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Mouse BEST2 Polyclonal Antibody
PA84876MO-04 1 mg

Rabbit Anti-Mouse BEST2 Polyclonal Antibody

Sign In for Pricing
View Details
HINFP (NM_198971) Human 3' UTR Clone
SC207658 10 µg

HINFP (NM_198971) Human 3' UTR Clone

Sign In for Pricing
View Details
ZNF410 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2704406 1.0 µg DNA

ZNF410 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details