Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bend6 Rabbit Polyclonal Antibody (FITC)

Bend6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RGD1310392

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FINDLMQVLYTNEYMATHSLTGAKSSTSRDKVVKPAMNQNEVQEIIGILK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102262

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLA1 Antibody
OAAB19746-100UL 100 µL

POLA1 Antibody

Sign In for Pricing
View Details
RPS8P4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2019206 1.0 µg DNA

RPS8P4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Lentiviral mouse Npb shRNA (UAS) - Lentiviral mouse Npb shRNA (UAS, RFP) (100)
GTR15177828 1 Vial

Lentiviral mouse Npb shRNA (UAS) - Lentiviral mouse Npb shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Human DNA damage-regulated autophagy modulator protein 1 (DRAM1)
orb2911933-01 20 µg

Recombinant Human DNA damage-regulated autophagy modulator protein 1 (DRAM1)

Sign In for Pricing
View Details
Recombinant Human DNA damage-regulated autophagy modulator protein 1 (DRAM1)
orb2911933-02 100 µg

Recombinant Human DNA damage-regulated autophagy modulator protein 1 (DRAM1)

Sign In for Pricing
View Details
Rabbit Polyclonal FAM189B Antibody
NBP1-98344 100 µL

Rabbit Polyclonal FAM189B Antibody

Sign In for Pricing
View Details