Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATXN7L1 Rabbit Polyclonal Antibody (FITC)

ATXN7L1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ATXN7L4

UniProt

A4D0Q2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ATXN7L1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689962

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAF2 HDR Plasmid (h)
sc-417274-HDR 20 µg

YAF2 HDR Plasmid (h)

Sign In for Pricing
View Details
PKC theta (PRKCQ) pSer676 Rabbit Polyclonal Antibody
AP20801PU-N 100 µg

PKC theta (PRKCQ) pSer676 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NCK1 (Cytoplasmic Protein Nck1, MGC12668, Nck1, Nck-1, Nck Adaptor Protein 1, SH2/SH3 Adaptor Protein NCK-alpha, SH2/SH3 Adaptor Protein NCK-alpha, NCK) (MaxLight 490)
MBS6386540-01 0.1 mL

NCK1 (Cytoplasmic Protein Nck1, MGC12668, Nck1, Nck-1, Nck Adaptor Protein 1, SH2/SH3 Adaptor Protein NCK-alpha, SH2/SH3 Adaptor Protein NCK-alpha, NCK) (MaxLight 490)

Sign In for Pricing
View Details
NCK1 (Cytoplasmic Protein Nck1, MGC12668, Nck1, Nck-1, Nck Adaptor Protein 1, SH2/SH3 Adaptor Protein NCK-alpha, SH2/SH3 Adaptor Protein NCK-alpha, NCK) (MaxLight 490)
MBS6386540-02 5x 0.1 mL

NCK1 (Cytoplasmic Protein Nck1, MGC12668, Nck1, Nck-1, Nck Adaptor Protein 1, SH2/SH3 Adaptor Protein NCK-alpha, SH2/SH3 Adaptor Protein NCK-alpha, NCK) (MaxLight 490)

Sign In for Pricing
View Details
AGPAT2 Knockout jurkat Polyclonal Cells
ARG33767 1 Million

AGPAT2 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
PT7-6xHis-EGFR-6xHis Plasmid
PVT80240 2 µg

PT7-6xHis-EGFR-6xHis Plasmid

Sign In for Pricing
View Details