Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C10orf30 Rabbit Polyclonal Antibody (HRP)

C10orf30 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C10orf30

UniProt

Q8N7W2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C10orf30

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689964

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Congo Red *UltraPure grade* *CAS 573-58-0*
23056-AAT 100 mg

Congo Red *UltraPure grade* *CAS 573-58-0*

Sign In for Pricing
View Details
FER (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 6B9]
AM00060PU-N 100 µg

FER (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 6B9]

Sign In for Pricing
View Details
Hexokinase II (HK2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C5]
TA500856BM 100 µL

Hexokinase II (HK2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C5]

Sign In for Pricing
View Details
N-Despropyl Gamithromycin 10,13-Imino Ether
TRC-D297410-5MG 5 mg

N-Despropyl Gamithromycin 10,13-Imino Ether

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF488A conjugate, 0.1mg/mL
BNC882200-500 1x 500 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CKAP1 (TBCB) Mouse Monoclonal Antibody [Clone ID: AT1F6]
AM50094PU-N 100 µL

CKAP1 (TBCB) Mouse Monoclonal Antibody [Clone ID: AT1F6]

Sign In for Pricing
View Details