Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMA3D Rabbit Polyclonal Antibody (HRP)

SEMA3D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Coll-2, Sema-Z2

UniProt

O95025

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SEMA3D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689967

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human STX2 Protein, N-His
HW789012-01 50 µg

Recombinant Human STX2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human STX2 Protein, N-His
HW789012-02 100 µg

Recombinant Human STX2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human STX2 Protein, N-His
HW789012-03 1 mg

Recombinant Human STX2 Protein, N-His

Sign In for Pricing
View Details
Bovine Guanylate Cyclase Activator 2B ELISA Kit
MBS053275-01 48 Well

Bovine Guanylate Cyclase Activator 2B ELISA Kit

Sign In for Pricing
View Details
Bovine Guanylate Cyclase Activator 2B ELISA Kit
MBS053275-02 96 Well

Bovine Guanylate Cyclase Activator 2B ELISA Kit

Sign In for Pricing
View Details
Bovine Guanylate Cyclase Activator 2B ELISA Kit
MBS053275-03 5x 96 Well

Bovine Guanylate Cyclase Activator 2B ELISA Kit

Sign In for Pricing
View Details