Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16orf73 Rabbit Polyclonal Antibody (Biotin)

C16orf73 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gs129, SPGF22, C16orf73

UniProt

Q8N635

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C16orf73

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689977

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Trichomonas Vaginalis TVAG_054490 Protein (aa 1-458) (Baculovirus)
VAng-Cr8529-50g 50 µg

Recombinant Trichomonas Vaginalis TVAG_054490 Protein (aa 1-458) (Baculovirus)

Sign In for Pricing
View Details
E/E072/NL533-PE-450X150/1 Safety & Regulatory Compliance Signs & Labels (Adhesive)
320314 1 Pack (1 Panel (s) x 1 Pack)

E/E072/NL533-PE-450X150/1 Safety & Regulatory Compliance Signs & Labels (Adhesive)

Sign In for Pricing
View Details
MuRF1 Rabbit Polyclonal Antibody (BF750)
orb1577599 100 µL

MuRF1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
CASP6 Antibody Blocking peptide
orb1456706 500 µg

CASP6 Antibody Blocking peptide

Sign In for Pricing
View Details
Rabbit Polyclonal FAM46A Antibody
NBP3-04800-20ul 20 µL

Rabbit Polyclonal FAM46A Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ing2 shRNA (UAS) - Lentiviral mouse Ing2 shRNA (UAS, GFP) (100)
GTR15235677 1 Vial

Lentiviral mouse Ing2 shRNA (UAS) - Lentiviral mouse Ing2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details