Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16orf73 Rabbit Polyclonal Antibody (Biotin)

C16orf73 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gs129, SPGF22, C16orf73

UniProt

Q8N635

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C16orf73

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689977

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cyclophilin-F Antibody (1F5) [DyLight 594]
NBP1-28608DL594 0.1 mL

Mouse Monoclonal Cyclophilin-F Antibody (1F5) [DyLight 594]

Sign In for Pricing
View Details
Bovine Kell Blood Group Glycoprotein (KEL) ELISA Kit
MBS9928380-01 48 Well

Bovine Kell Blood Group Glycoprotein (KEL) ELISA Kit

Sign In for Pricing
View Details
Bovine Kell Blood Group Glycoprotein (KEL) ELISA Kit
MBS9928380-02 96 Well

Bovine Kell Blood Group Glycoprotein (KEL) ELISA Kit

Sign In for Pricing
View Details
Bovine Kell Blood Group Glycoprotein (KEL) ELISA Kit
MBS9928380-03 5x 96 Well

Bovine Kell Blood Group Glycoprotein (KEL) ELISA Kit

Sign In for Pricing
View Details
Bovine Kell Blood Group Glycoprotein (KEL) ELISA Kit
MBS9928380-04 10x 96 Well

Bovine Kell Blood Group Glycoprotein (KEL) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human IDE Protein
MBS8249188-01 0.01 mg

Recombinant Human IDE Protein

Sign In for Pricing
View Details