Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC110 Rabbit Polyclonal Antibody (HRP)

CCDC110 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT52, KMHN1, KM-HN-1

UniProt

Q8TBZ0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCDC110

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KEELKKHSQENIKFENSISRLTEDKILLENYVRSIENERDTLEFEMRHLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689988

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNNA1 Protein Vector (Rat) (pPB-N-His)
PV262239 500 ng

CTNNA1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
MAP Kinase 14 (Mitogen-activated Protein Kinase 14, MAPK 14, MAPK14, Mitogen-activated Protein Kinase p38alpha, MAP Kinase p38alpha, Cytokine Suppressive Anti-inflammatory Drug Binding Protein, CSAID Binding Protein, CSBP, MAX-interacting Protein 2, MAP Kinase MXI2, SAPK2A) (AP) discontinued
M2352-03X-AP 100 µL

MAP Kinase 14 (Mitogen-activated Protein Kinase 14, MAPK 14, MAPK14, Mitogen-activated Protein Kinase p38alpha, MAP Kinase p38alpha, Cytokine Suppressive Anti-inflammatory Drug Binding Protein, CSAID Binding Protein, CSBP, MAX-interacting Protein 2, MAP Kinase MXI2, SAPK2A) (AP) discontinued

Sign In for Pricing
View Details
OLIG3 Blocking Peptide
33R-6266 0.1 mg

OLIG3 Blocking Peptide

Sign In for Pricing
View Details
Human MICALL2 Pre-designed siRNA Set A
SI009568A 1 Each

Human MICALL2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CLASP2 Rabbit Polyclonal Antibody (PE-Cy5)
orb869175 100 µL

CLASP2 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Recombinant Streptococcus thermophilus Translation initiation factor IF-3 (infC)
MBS1421377-01 0.02 mg (E-Coli)

Recombinant Streptococcus thermophilus Translation initiation factor IF-3 (infC)

Sign In for Pricing
View Details