Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC197 Rabbit Polyclonal Antibody (Biotin)

CCDC197 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C14orf48, c14_5713, LINC00521

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf48

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_689990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM12 (KIAA0765, RNA-binding Protein 12, RNA-binding Motif Protein 12, SH3/WW Domain Anchor Protein in the Nucleus) (FITC)
132387-FITC 100 µL

RBM12 (KIAA0765, RNA-binding Protein 12, RNA-binding Motif Protein 12, SH3/WW Domain Anchor Protein in the Nucleus) (FITC)

Sign In for Pricing
View Details
1,4-Butanediol Diglycidyl Ether
TRC-B701365-1G 1 g

1,4-Butanediol Diglycidyl Ether

Sign In for Pricing
View Details
Insulin receptor substrate 1 IRS1 Rabbit Polyclonal Antibody (Cy3)
orb2574436 100 µg

Insulin receptor substrate 1 IRS1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
2510049J12Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3164106 1.0 µg DNA

2510049J12Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
POU2F1/OCT1 Rabbit pAb
E45R20114N-50 50 µL

POU2F1/OCT1 Rabbit pAb

Sign In for Pricing
View Details
pBluescriptR-GADD45A Plasmid
PVT21273 2 µg

pBluescriptR-GADD45A Plasmid

Sign In for Pricing
View Details